PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11052_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 315aa    MW: 36187.1 Da    PI: 6.9816
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11052_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.2e-41174250177
                                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
                                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                                           +Cqv+gC +dls+ k+y++rh+vC++hsk+++v+++g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerr
  cra_locus_11052_iso_2_len_1286_ver_3 174 ICQVQGCYKDLSSSKDYYKRHRVCDIHSKTAKVVINGIEQRFCQQCSRFHLLVEFDNGKRSCRKRLAGHNERR 246
                                           5************************************************************************ PP

                                           -S-- CS
                                   SBP  74 rkkq 77 
                                           rk+q
  cra_locus_11052_iso_2_len_1286_ver_3 247 RKPQ 250
                                           **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-33171236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.65172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.76E-39173252IPR004333Transcription factor, SBP-box
PfamPF031101.9E-31175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MEFQELYWEN KSSVFLDNIE FPIDVLVRNK NFVRNLEIKD LCDFDKDGLD LDRETVDDIG  60
FIETIFHHGM SKSALDSPGF GVSSGEISDS SINKVTSTSI INLGHSTKEM GFGTVFEHNN  120
EKESMIGKEL DKYADSKEVS SMLSSEESLI SSLMEHSLPT KRARNTGLYP QIPICQVQGC  180
YKDLSSSKDY YKRHRVCDIH SKTAKVVING IEQRFCQQCS RFHLLVEFDN GKRSCRKRLA  240
GHNERRRKPQ LGAHLGKPLT LLILFSLEIF ASFGCVKFPY FVIPLLENFV YLLSFLPFWL  300
HLNAYLWHFV FTHAX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-301742481084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068TVY44e-79A0A068TVY4_COFCA; Uncharacterized protein